Procurement answer: Davalintide is a peptide-related raw material inquiry option. This item appears in the supplied third-party catalog reference; availability for Hytanbio projects must be confirmed by quotation. Request a current specification, batch COA, MOQ, lead time and destination review before committing to an order. Public parameters below are source-listed references, not guarantees for a current batch.
Davalintide specifications and available formats
Start with the exact identity and commercial form of Davalintide before comparing quotations. A product name can refer to different salts, counterions, terminal modifications, hydration states, fill strengths or packaging formats, so the name alone is not a complete purchasing specification. This page classifies the item under Catalog Peptides and displays only plausible fields found in the supplied peptide raw-material catalog. Missing CAS, sequence, molecular formula, molecular weight or storage data are left for technical confirmation instead of being estimated. Ask the supplier to state which values describe a target specification and which were measured for the offered batch. For lyophilized formats, confirm the quantity per vial, number of vials, excipients, container and closure, cake appearance and allowable fill variation. For bulk materials, confirm net weight, inner packaging, outer packaging and sampling method. The signed specification and current batch documents take priority over public catalog data.
| CAS number | 863919-85-1 |
|---|---|
| Molecular formula | C152H248N50O49S2 |
| Molecular weight | 3624.03 |
| Sequence | KCNTATCVLGRLSQELHRLQTYPRTNTGSNTY-NH2(Disulfidebond |
| Source-listed packaging | Apperance: White to off-white powder Purity(HPLC) ≥ 98.0% |
Batch quality and documentation
Quality review for Davalintide should connect every claimed result to a named batch, method and acceptance limit. Request a current certificate of analysis that identifies the lot, material form, issue date, analytical method, measured result and release decision. HPLC can describe chromatographic purity only under the stated method; it does not by itself prove identity, water content, residual-solvent compliance, microbial quality or endotoxin control. Mass spectrometry, water testing, residual-solvent analysis and other methods should be agreed when they matter to the project. Ask how samples are taken, retained and linked to packaging labels, and check whether any facility or quality-system certificate covers the legal entity, location and activity used for the quotation. A sample certificate, website badge or packaging mockup is not evidence for a future lot. Buyers should resolve inconsistencies before approval and retain the final specification, COA and correspondence in their supplier file.
MOQ, packaging and quotation
MOQ, lead time and price for Davalintide depend on the requested form, purity target, scale, testing plan, packaging and destination. Send the required quantity, annual forecast, target delivery date, destination country, intended laboratory or industrial context, document list and any private-label artwork status in one structured RFQ. The supplier can then separate current inventory from made-to-order material, identify a feasible sample route and quote the correct container, labeling and export documents. A small trial, gram-scale request, kilogram-scale batch and multi-product mixed order may have different production and release constraints, so a universal MOQ would be misleading. Final lead time should state whether it begins after technical approval, sample approval, artwork approval or payment. Shipping remains subject to product classification and buyer-side import eligibility. The website image is a packaging concept; actual lot appearance and labels are confirmed during quotation. No public price or stock label replaces a written commercial offer.